Lineage for d1qrzb_ (1qrz B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111930Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 111931Species Human (Homo sapiens) [TaxId:9606] [50589] (4 PDB entries)
  8. 111937Domain d1qrzb_: 1qrz B: [26367]

Details for d1qrzb_

PDB Entry: 1qrz (more details), 2 Å

PDB Description: catalytic domain of plasminogen

SCOP Domain Sequences for d1qrzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrzb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
fdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgqhfcggtlispewvltaahcl
eksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipa
clpspnymvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqstel
caghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwie
gvlrnn

SCOP Domain Coordinates for d1qrzb_:

Click to download the PDB-style file with coordinates for d1qrzb_.
(The format of our PDB-style files is described here.)

Timeline for d1qrzb_: