Lineage for d4q61i_ (4q61 I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891450Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 1891451Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 1891626Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 1891627Protein automated matches [191122] (9 species)
    not a true protein
  7. 1891653Species Helicobacter pylori [TaxId:85962] [257621] (2 PDB entries)
  8. 1891672Domain d4q61i_: 4q61 I: [263641]
    automated match to d4q61a_
    complexed with amp

Details for d4q61i_

PDB Entry: 4q61 (more details), 2.95 Å

PDB Description: hit like protein from helicobacter pylori 26695
PDB Compounds: (I:) Uncharacterized HIT-like protein HP_0404

SCOPe Domain Sequences for d4q61i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q61i_ d.13.1.0 (I:) automated matches {Helicobacter pylori [TaxId: 85962]}
mnvfekiiqgeipcskilenerflsfydinpkakvhalvipkqsiqdfngitpelmaqmt
sfifevveklgikekgyklltnvgknagqevmhlhfhilsgd

SCOPe Domain Coordinates for d4q61i_:

Click to download the PDB-style file with coordinates for d4q61i_.
(The format of our PDB-style files is described here.)

Timeline for d4q61i_:

  • d4q61i_ is new in SCOPe 2.05-stable
  • d4q61i_ does not appear in SCOPe 2.06