Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (5 families) |
Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
Protein automated matches [191122] (9 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [257621] (2 PDB entries) |
Domain d4q61h_: 4q61 H: [263640] automated match to d4q61a_ complexed with amp |
PDB Entry: 4q61 (more details), 2.95 Å
SCOPe Domain Sequences for d4q61h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q61h_ d.13.1.0 (H:) automated matches {Helicobacter pylori [TaxId: 85962]} mnvfekiiqgeipcskilenerflsfydinpkakvhalvipkqsiqdfngitpelmaqmt sfifevveklgikekgyklltnvgknagqevmhlhfhilsg
Timeline for d4q61h_: