Lineage for d1ddjc_ (1ddj C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405278Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 2405279Species Human (Homo sapiens) [TaxId:9606] [50589] (10 PDB entries)
  8. 2405284Domain d1ddjc_: 1ddj C: [26364]

Details for d1ddjc_

PDB Entry: 1ddj (more details), 2 Å

PDB Description: crystal structure of human plasminogen catalytic domain
PDB Compounds: (C:) plasminogen

SCOPe Domain Sequences for d1ddjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddjc_ b.47.1.2 (C:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
sfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahc
leksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvip
aclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqste
lcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwi
egvmrnn

SCOPe Domain Coordinates for d1ddjc_:

Click to download the PDB-style file with coordinates for d1ddjc_.
(The format of our PDB-style files is described here.)

Timeline for d1ddjc_: