Lineage for d4q2ul_ (4q2u L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010146Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 3010147Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 3010183Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 3010184Protein automated matches [191236] (7 species)
    not a true protein
  7. 3010190Species Escherichia coli [TaxId:83333] [257085] (4 PDB entries)
  8. 3010199Domain d4q2ul_: 4q2u L: [263617]
    automated match to d4mmga_
    protein/DNA complex; complexed with so4

Details for d4q2ul_

PDB Entry: 4q2u (more details), 1.8 Å

PDB Description: Crystal structure of the E. coli DinJ-YafQ toxin-antitoxin complex
PDB Compounds: (L:) mRNA interferase YafQ

SCOPe Domain Sequences for d4q2ul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q2ul_ d.298.1.0 (L:) automated matches {Escherichia coli [TaxId: 83333]}
iqrdieysgqyskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqgswkgyrd
ahvepdwiliykltdkllrfertgthaalfg

SCOPe Domain Coordinates for d4q2ul_:

Click to download the PDB-style file with coordinates for d4q2ul_.
(The format of our PDB-style files is described here.)

Timeline for d4q2ul_: