Lineage for d4phxh1 (4phx H:1-131)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377642Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2377643Protein automated matches [190503] (10 species)
    not a true protein
  7. 2377667Species Escherichia coli [TaxId:562] [187451] (6 PDB entries)
  8. 2377684Domain d4phxh1: 4phx H:1-131 [263492]
    Other proteins in same PDB: d4phxa2, d4phxb2, d4phxc2, d4phxd2, d4phxe2, d4phxf2, d4phxg2, d4phxh2
    automated match to d4phxc_

Details for d4phxh1

PDB Entry: 4phx (more details), 2.4 Å

PDB Description: crystal structure of aggb, the minor subunit of aggregative adherence fimbriae type i from the escherichia coli o4h104
PDB Compounds: (H:) Protein AggB

SCOPe Domain Sequences for d4phxh1:

Sequence, based on SEQRES records: (download)

>d4phxh1 b.2.3.0 (H:1-131) automated matches {Escherichia coli [TaxId: 562]}
aeitlishktlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnretkh
elkvkiggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisr
gdnkqalerpp

Sequence, based on observed residues (ATOM records): (download)

>d4phxh1 b.2.3.0 (H:1-131) automated matches {Escherichia coli [TaxId: 562]}
aeitlihtlgsqlrdgmlatgriacrephgfhiwinsqngkvghyivqnnrethelkvki
ggggwsssligqgvyrqgeekqaifdimsdgnqysageyifsvsgeclisrlpp

SCOPe Domain Coordinates for d4phxh1:

Click to download the PDB-style file with coordinates for d4phxh1.
(The format of our PDB-style files is described here.)

Timeline for d4phxh1: