Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
Protein automated matches [190503] (10 species) not a true protein |
Species Escherichia coli [TaxId:562] [187451] (6 PDB entries) |
Domain d4phxh1: 4phx H:1-131 [263492] Other proteins in same PDB: d4phxa2, d4phxb2, d4phxc2, d4phxd2, d4phxe2, d4phxf2, d4phxg2, d4phxh2 automated match to d4phxc_ |
PDB Entry: 4phx (more details), 2.4 Å
SCOPe Domain Sequences for d4phxh1:
Sequence, based on SEQRES records: (download)
>d4phxh1 b.2.3.0 (H:1-131) automated matches {Escherichia coli [TaxId: 562]} aeitlishktlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnretkh elkvkiggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisr gdnkqalerpp
>d4phxh1 b.2.3.0 (H:1-131) automated matches {Escherichia coli [TaxId: 562]} aeitlihtlgsqlrdgmlatgriacrephgfhiwinsqngkvghyivqnnrethelkvki ggggwsssligqgvyrqgeekqaifdimsdgnqysageyifsvsgeclisrlpp
Timeline for d4phxh1: