![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) ![]() |
![]() | Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
![]() | Protein automated matches [257397] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [257398] (2 PDB entries) |
![]() | Domain d4p3ad1: 4p3a D:679-746 [263432] Other proteins in same PDB: d4p3aa2, d4p3ab2, d4p3ac2, d4p3ad2 automated match to d1kjsa_ complexed with fmt |
PDB Entry: 4p3a (more details), 1.4 Å
SCOPe Domain Sequences for d4p3ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3ad1 a.50.1.1 (D:679-746) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nlhllrqkieeqaakykhsvpkkccydgarvnfyetceervarvtigplcirafneccti ankirkes
Timeline for d4p3ad1: