Class a: All alpha proteins [46456] (290 folds) |
Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) |
Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
Protein C5a anaphylotoxin [47688] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries) |
Domain d4p39b1: 4p39 B:678-745 [263428] Other proteins in same PDB: d4p39a2, d4p39b2 automated match to d4p39a_ |
PDB Entry: 4p39 (more details), 2.4 Å
SCOPe Domain Sequences for d4p39b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p39b1 a.50.1.1 (B:678-745) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]} tlqkkieeiaakykhsvvkkccydgarvnndetceqraarislgprcikafteccvvasq lranisfk
Timeline for d4p39b1:
View in 3D Domains from other chains: (mouse over for more information) d4p39a1, d4p39a2, d4p39c_, d4p39d_ |