Lineage for d4p39b1 (4p39 B:678-745)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714706Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714707Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2714708Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2714712Protein C5a anaphylotoxin [47688] (2 species)
  7. 2714713Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 2714715Domain d4p39b1: 4p39 B:678-745 [263428]
    Other proteins in same PDB: d4p39a2, d4p39b2
    automated match to d4p39a_

Details for d4p39b1

PDB Entry: 4p39 (more details), 2.4 Å

PDB Description: crystal structure of the human c5ar antagonist c5a-a8
PDB Compounds: (B:) Complement C5

SCOPe Domain Sequences for d4p39b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p39b1 a.50.1.1 (B:678-745) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
tlqkkieeiaakykhsvvkkccydgarvnndetceqraarislgprcikafteccvvasq
lranisfk

SCOPe Domain Coordinates for d4p39b1:

Click to download the PDB-style file with coordinates for d4p39b1.
(The format of our PDB-style files is described here.)

Timeline for d4p39b1: