Lineage for d4ow1x_ (4ow1 X:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533682Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2533683Protein automated matches [190563] (18 species)
    not a true protein
  7. 2533718Species Mycobacterium tuberculosis [TaxId:1773] [236519] (2 PDB entries)
  8. 2533726Domain d4ow1x_: 4ow1 X: [263360]
    automated match to d4ow1a_
    complexed with edo

Details for d4ow1x_

PDB Entry: 4ow1 (more details), 1.9 Å

PDB Description: crystal structure of resuscitation promoting factor c
PDB Compounds: (X:) Resuscitation-promoting factor RpfC

SCOPe Domain Sequences for d4ow1x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ow1x_ d.2.1.0 (X:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
spnwdavaqcesggnwaantgngkygglqfkpatwaafggvgnpaaasreqqiavanrvl
aeqgldawptcgaasglp

SCOPe Domain Coordinates for d4ow1x_:

Click to download the PDB-style file with coordinates for d4ow1x_.
(The format of our PDB-style files is described here.)

Timeline for d4ow1x_: