Lineage for d4omcf1 (4omc F:110-442)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481297Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2481298Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2481299Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2481611Protein automated matches [190073] (16 species)
    not a true protein
  7. 2481709Species Human (Homo sapiens) [TaxId:9606] [238473] (11 PDB entries)
  8. 2481723Domain d4omcf1: 4omc F:110-442 [263319]
    Other proteins in same PDB: d4omca2, d4omcb2, d4omcc2, d4omcd2, d4omce2, d4omcf2
    automated match to d1p8ja2
    complexed with ca, fmt, na

Details for d4omcf1

PDB Entry: 4omc (more details), 2.3 Å

PDB Description: X-ray structure of human furin in complex with the competitive inhibitor meta-guanidinomethyl-Phac-RVR-Amba
PDB Compounds: (F:) Furin

SCOPe Domain Sequences for d4omcf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omcf1 c.41.1.1 (F:110-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
dwatngvgrkvshsygyglldagamvalaqnwt

SCOPe Domain Coordinates for d4omcf1:

Click to download the PDB-style file with coordinates for d4omcf1.
(The format of our PDB-style files is described here.)

Timeline for d4omcf1: