Lineage for d4ntke_ (4ntk E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572796Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2572797Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2573513Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2573514Protein automated matches [227009] (15 species)
    not a true protein
  7. 2573567Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries)
  8. 2573571Domain d4ntke_: 4ntk E: [263224]
    automated match to d4ntka_
    complexed with act, zn, zsp

Details for d4ntke_

PDB Entry: 4ntk (more details), 1.6 Å

PDB Description: qued from e. coli
PDB Compounds: (E:) 6-carboxy-5,6,7,8-tetrahydropterin synthase

SCOPe Domain Sequences for d4ntke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ntke_ d.96.1.0 (E:) automated matches {Escherichia coli [TaxId: 469008]}
msttlfkdftfeaahrlphvpeghkagrlhghsfmvrleitgevdphtgwiidfaelkaa
fkptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyrge

SCOPe Domain Coordinates for d4ntke_:

Click to download the PDB-style file with coordinates for d4ntke_.
(The format of our PDB-style files is described here.)

Timeline for d4ntke_: