SCOPe 2.05: Domain d4ntkd_: 4ntk D:

Lineage for d4ntkd_ (4ntk D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries)

8. Domain d4ntkd_: 4ntk D: [263223]
   automated match to d4ntka_
   complexed with act, zn, zsp

Details for d4ntkd_

PDB Entry: 4ntk, 1.6 Å

PDB Description: qued from e. coli

PDB Compounds: (D:) 6-carboxy-5,6,7,8-tetrahydropterin synthase

SCOPe Domain Sequences for d4ntkd_:

Sequence; same for both SEQRES and ATOM records:

>d4ntkd_ d.96.1.0 (D:) automated matches {Escherichia coli [TaxId: 469008]}
sttlfkdftfeaahrlphvpeghkagrlhghsfmvrleitgevdphtgwiidfaelkaaf
kptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyrge

Timeline for d4ntkd_:

• d4ntkd_ is new in SCOPe 2.05-stable
  
• d4ntkd_ appears in SCOPe 2.06
  
• d4ntkd_ appears in the current release, SCOPe 2.08