Lineage for d4ncpe_ (4ncp E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944593Species Staphylococcus aureus [TaxId:158878] [260692] (8 PDB entries)
  8. 2944611Domain d4ncpe_: 4ncp E: [263116]
    automated match to d4ncpc_

Details for d4ncpe_

PDB Entry: 4ncp (more details), 2.5 Å

PDB Description: crystal structure of 4-hbt like thioesterase sav1878 from staphylococcus aureus subsp. aureus mu50
PDB Compounds: (E:) Uncharacterized protein

SCOPe Domain Sequences for d4ncpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ncpe_ d.38.1.0 (E:) automated matches {Staphylococcus aureus [TaxId: 158878]}
pmksmseskcyknrqvfpqdtnhhhtmfggtlmanideiaaitamkhagaqvvtastdsv
dflkpiktgdilqyvamvsyagtssmevvvqiriddvfnnkhdlaalsyltfvalddegk
pkhvpgvypeddvekwfydtapqrverrkarrieskqtieyl

SCOPe Domain Coordinates for d4ncpe_:

Click to download the PDB-style file with coordinates for d4ncpe_.
(The format of our PDB-style files is described here.)

Timeline for d4ncpe_: