SCOPe 2.06: Domain d4ncpb_: 4ncp B:

Lineage for d4ncpb_ (4ncp B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (36 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [260692] (8 PDB entries)

8. Domain d4ncpb_: 4ncp B: [263114]
   automated match to d4ncpc_

Details for d4ncpb_

PDB Entry: 4ncp, 2.5 Å

PDB Description: crystal structure of 4-hbt like thioesterase sav1878 from staphylococcus aureus subsp. aureus mu50

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d4ncpb_:

Sequence; same for both SEQRES and ATOM records:

>d4ncpb_ d.38.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
pmksmseskcyknrqvfpqdtnhhhtmfggtlmanideiaaitamkhagaqvvtastdsv
dflkpiktgdilqyvamvsyagtssmevvvqiriddvfnnkhdlaalsyltfvalddegk
pkhvpgvypeddvekwfydtapqrverrkarrieskqtieyl

Timeline for d4ncpb_:

• d4ncpb_ first appeared in SCOPe 2.05
  
• d4ncpb_ appears in SCOPe 2.07
  
• d4ncpb_ appears in the current release, SCOPe 2.08