SCOP 1.65: Domain d2kai.1: 2kai A:,B:

Lineage for d2kai.1 (2kai A:,B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)

6. Protein Kallikrein A [50555] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)

8. Domain d2kai.1: 2kai A:,B: [26306]
   Other proteins in same PDB: d2kaii_

Details for d2kai.1

PDB Entry: 2kai, 2.5 Å

PDB Description: refined 2.5 angstroms x-ray crystal structure of the complex formed by porcine kallikrein a and the bovine pancreatic trypsin inhibitor. crystallization, patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex

SCOP Domain Sequences for d2kai.1:

Sequence; same for both SEQRES and ATOM records:

>g2kai.1 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa)}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXadgkdyshdlmllrlqspakitdavkvlelptqepelgs
tceasgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdt
cmgdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

Timeline for d2kai.1:

• d2kai.1 first appeared (with stable ids) in SCOP 1.55
  
• d2kai.1 appears in SCOP 1.63
  
• d2kai.1 appears in SCOP 1.67
  
• d2kai.1 appears in the current release, SCOPe 2.08