SCOPe 2.06: Domain d1hia.2: 1hia X:,Y:

Lineage for d1hia.2 (1hia X:,Y:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Kallikrein A [50555] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)

8. Domain d1hia.2: 1hia X:,Y: [26305]
   Other proteins in same PDB: d1hiai_, d1hiaj_

Details for d1hia.2

PDB Entry: 1hia, 2.4 Å

PDB Description: kallikrein complexed with hirustasin

PDB Compounds: (X:) kallikrein, (Y:) kallikrein

SCOPe Domain Sequences for d1hia.2:

Sequence; same for both SEQRES and ATOM records:

>g1hia.2 b.47.1.2 (X:,Y:) Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXgkdyshdlmllrlqspakitdavkvlelptqepelgstc
easgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcm
gdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

Timeline for d1hia.2:

• d1hia.2 first appeared (with stable ids) in SCOP 1.55
  
• d1hia.2 appears in SCOPe 2.05
  
• d1hia.2 appears in SCOPe 2.07
  
• d1hia.2 appears in the current release, SCOPe 2.08