Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Kallikrein A [50555] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries) |
Domain d1hia.2: 1hia X:,Y: [26305] Other proteins in same PDB: d1hiai_, d1hiaj_ |
PDB Entry: 1hia (more details), 2.4 Å
SCOPe Domain Sequences for d1hia.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1hia.2 b.47.1.2 (X:,Y:) Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene ntaqffgvtadfphpgfnlsXgkdyshdlmllrlqspakitdavkvlelptqepelgstc easgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcm gdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp
Timeline for d1hia.2: