Lineage for d1hia.2 (1hia X:,Y:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111904Protein Kallikrein A [50555] (1 species)
  7. 111905Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)
  8. 111909Domain d1hia.2: 1hia X:,Y: [26305]
    Other proteins in same PDB: d1hiai_, d1hiaj_

Details for d1hia.2

PDB Entry: 1hia (more details), 2.4 Å

PDB Description: kallikrein complexed with hirustasin

SCOP Domain Sequences for d1hia.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1hia.2 b.47.1.2 (X:,Y:) Kallikrein A {Pig (Sus scrofa)}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXgkdyshdlmllrlqspakitdavkvlelptqepelgstc
easgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcm
gdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

SCOP Domain Coordinates for d1hia.2:

Click to download the PDB-style file with coordinates for d1hia.2.
(The format of our PDB-style files is described here.)

Timeline for d1hia.2: