Lineage for d1hia.1 (1hia A:,B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60643Protein Kallikrein A [50555] (1 species)
  7. 60644Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)
  8. 60647Domain d1hia.1: 1hia A:,B: [26304]
    Other proteins in same PDB: d1hiai_, d1hiaj_

Details for d1hia.1

PDB Entry: 1hia (more details), 2.4 Å

PDB Description: kallikrein complexed with hirustasin

SCOP Domain Sequences for d1hia.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1hia.1 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa)}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXgkdyshdlmllrlqspakitdavkvlelptqepelgstc
easgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdtcm
gdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

SCOP Domain Coordinates for d1hia.1:

Click to download the PDB-style file with coordinates for d1hia.1.
(The format of our PDB-style files is described here.)

Timeline for d1hia.1: