SCOPe 2.05: Domain d1pjpa_: 1pjp A:

Lineage for d1pjpa_ (1pjp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Chymase (mast cell protease I) [89343] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89344] (11 PDB entries)

8. Domain d1pjpa_: 1pjp A: [26301]
   complexed with nag, zn

Details for d1pjpa_

PDB Entry: 1pjp, 2.2 Å

PDB Description: the 2.2 a crystal structure of human chymase in complex with succinyl- ala-ala-pro-phe-chloromethylketone

PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d1pjpa_:

Sequence; same for both SEQRES and ATOM records:

>d1pjpa_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqknfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagaaqgivsygrsdakppavftrishyqpwinqilqan

Timeline for d1pjpa_:

• d1pjpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1pjpa_ appears in SCOPe 2.04
  
• d1pjpa_ appears in SCOPe 2.06
  
• d1pjpa_ appears in the current release, SCOPe 2.08