SCOPe 2.03: Domain d3rp2b_: 3rp2 B:

Lineage for d3rp2b_ (3rp2 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Chymase II (mast cell proteinase II) [50552] (1 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [50553] (1 PDB entry)

8. Domain d3rp2b_: 3rp2 B: [26299]

Details for d3rp2b_

PDB Entry: 3rp2, 1.9 Å

PDB Description: the structure of rat mast cell protease ii at 1.9-angstroms resolution

PDB Compounds: (B:) rat mast cell protease II

SCOPe Domain Sequences for d3rp2b_:

Sequence; same for both SEQRES and ATOM records:

>d3rp2b_ b.47.1.2 (B:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]}
iiggvesiphsrpymahldivtekglrvicggflisrqfvltaahckgreitvilgahdv
rkrestqqkikvekqiihesynsvpnlhdimllklekkveltpavnvvplpspsdfihpg
amcwaagwgktgvrdptsytlrevelrimdekacvdyryyeykfqvcvgspttlraafmg
dsggpllcagvahgivsyghpdakppaiftrvstyvpwinavin

Timeline for d3rp2b_:

• d3rp2b_ first appeared (with stable ids) in SCOP 1.55
  
• d3rp2b_ appears in SCOPe 2.02
  
• d3rp2b_ appears in SCOPe 2.04
  
• d3rp2b_ appears in the current release, SCOPe 2.08