Lineage for d3rp2b_ (3rp2 B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14989Protein Chymase (Proteinase II) [50552] (2 species)
  7. 14993Species Rat (Rattus rattus) [TaxId:10117] [50553] (1 PDB entry)
  8. 14995Domain d3rp2b_: 3rp2 B: [26299]

Details for d3rp2b_

PDB Entry: 3rp2 (more details), 1.9 Å

PDB Description: the structure of rat mast cell protease ii at 1.9-angstroms resolution

SCOP Domain Sequences for d3rp2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rp2b_ b.47.1.2 (B:) Chymase (Proteinase II) {Rat (Rattus rattus)}
iiggvesiphsrpymahldivtekglrvicggflisrqfvltaahckgreitvilgahdv
rkrestqqkikvekqiihesynsvpnlhdimllklekkveltpavnvvplpspsdfihpg
amcwaagwgktgvrdptsytlrevelrimdekacvdyryyeykfqvcvgspttlraafmg
dsggpllcagvahgivsyghpdakppaiftrvstyvpwinavin

SCOP Domain Coordinates for d3rp2b_:

Click to download the PDB-style file with coordinates for d3rp2b_.
(The format of our PDB-style files is described here.)

Timeline for d3rp2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rp2a_