SCOPe 2.06: Domain d4l7qb_: 4l7q B:

Lineage for d4l7qb_ (4l7q B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (20 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [256984] (5 PDB entries)

8. Domain d4l7qb_: 4l7q B: [262905]
   automated match to d4l7qa_
   complexed with gol

Details for d4l7qb_

PDB Entry: 4l7q, 2.1 Å

PDB Description: Crystal structure of gamma glutamyl hydrolase (wild-type) from zebrafish

PDB Compounds: (B:) gamma-glutamyl hydrolase

SCOPe Domain Sequences for d4l7qb_:

Sequence; same for both SEQRES and ATOM records:

>d4l7qb_ c.23.16.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn

Timeline for d4l7qb_:

• d4l7qb_ first appeared in SCOPe 2.05
  
• d4l7qb_ appears in SCOPe 2.07
  
• d4l7qb_ appears in the current release, SCOPe 2.08