Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Heparin binding protein, HBP [50544] (1 species) multifunctional protein (synonym: CAP37, azurocidin) |
Species Human (Homo sapiens) [TaxId:9606] [50545] (4 PDB entries) |
Domain d1ae5a_: 1ae5 A: [26285] complexed with nag |
PDB Entry: 1ae5 (more details), 2.3 Å
SCOPe Domain Sequences for d1ae5a_:
Sequence, based on SEQRES records: (download)
>d1ae5a_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfqsqnpgvstvvlgaydl rrrerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveag trcqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdggtplv ceglahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa
>d1ae5a_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} ivggrkarprqfpflasiqnqgrhfcggaliharfvmtaascfqspgvstvvlgaydlrr rerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveagtr cqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdggtplvce glahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa
Timeline for d1ae5a_: