SCOPe 2.07: Domain d4k4be_: 4k4b E:

Lineage for d4k4be_ (4k4b E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein Hypothetical protein YdiI [102910] (1 species)

7. Species Escherichia coli [TaxId:562] [102911] (6 PDB entries)

8. Domain d4k4be_: 4k4b E: [262789]
   automated match to d1sbka_
   complexed with cl, uoq

Details for d4k4be_

PDB Entry: 4k4b, 1.9 Å

PDB Description: X-ray crystal structure of E. coli YdiI complexed with undeca-2-one-CoA

PDB Compounds: (E:) Esterase YdiI

SCOPe Domain Sequences for d4k4be_:

Sequence; same for both SEQRES and ATOM records:

>d4k4be_ d.38.1.5 (E:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]}
miwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
ekgrlccssrlttail

Timeline for d4k4be_:

• d4k4be_ first appeared in SCOPe 2.05
  
• d4k4be_ appears in SCOPe 2.06
  
• d4k4be_ appears in the current release, SCOPe 2.08