Lineage for d4igmd_ (4igm D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1820872Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1821491Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1821492Protein automated matches [190150] (22 species)
    not a true protein
  7. 1821563Species Human (Homo sapiens) [TaxId:9606] [189102] (6 PDB entries)
  8. 1821579Domain d4igmd_: 4igm D: [262719]
    automated match to d4ofca_
    complexed with zn

Details for d4igmd_

PDB Entry: 4igm (more details), 2.39 Å

PDB Description: 2.39 angstrom x-ray crystal structure of human acmsd
PDB Compounds: (D:) 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

SCOPe Domain Sequences for d4igmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4igmd_ c.1.9.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkidihshilpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrencwdpevri
remdqkgvtvqalstvpvmfsywakpedtlnlcqllnndlastvvsyprrfvglgtlpmq
apelavkemercvkelgfpgvqigthvnewdlnaqelfpvyaaaerlkcslfvhpwdmqm
dgrmakywlpwlvgmpaettiaicsmimggvfekfpklkvcfahgggafpftvgrishgf
smrpdlcaqdnpmnpkkylgsfytdalvhdplslklltdvigkdkvilgtdypfplgele
pgkliesmeefdeetknklkagnalaflgler

SCOPe Domain Coordinates for d4igmd_:

Click to download the PDB-style file with coordinates for d4igmd_.
(The format of our PDB-style files is described here.)

Timeline for d4igmd_: