SCOPe 2.06: Domain d4czmb2: 4czm B:150-344

Lineage for d4czmb2 (4czm B:150-344)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries)

8. Domain d4czmb2: 4czm B:150-344 [262678]
   automated match to d4czla2
   complexed with anp, mg

Details for d4czmb2

PDB Entry: 4czm, 2.2 Å

PDB Description: c. crescentus mreb, monomeric, amppnp

PDB Compounds: (B:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czmb2:

Sequence; same for both SEQRES and ATOM records:

>d4czmb2 c.55.1.0 (B:150-344) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapadgeglsidvkgrdlmqgvprevrisekqaadalaepvgqivea
vkvaleatppeladdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcg
kvlehpkwmkgvles

Timeline for d4czmb2:

• d4czmb2 first appeared in SCOPe 2.05
  
• d4czmb2 appears in SCOPe 2.07
  
• d4czmb2 appears in the current release, SCOPe 2.08