SCOPe 2.08: Domain d6esta_: 6est A:

Lineage for d6esta_ (6est A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)

8. Domain d6esta_: 6est A: [26263]
   complexed with ca, dmf, so4

Details for d6esta_

PDB Entry: 6est, 1.8 Å

PDB Description: interaction of the peptide cf3-leu-ala-nh-c6h4-cf3(tfla) with porcine pancreatic elastase. x-ray studies at 1.8 angstroms

PDB Compounds: (A:) porcine pancreatic elastase

SCOPe Domain Sequences for d6esta_:

Sequence; same for both SEQRES and ATOM records:

>d6esta_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d6esta_:

• d6esta_ first appeared (with stable ids) in SCOP 1.55, called d6est__
  
• d6esta_ appears in SCOPe 2.07