|  | Class b: All beta proteins [48724] (178 folds) | 
|  | Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily) barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices | 
|  | Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family)  automatically mapped to Pfam PF02312 | 
|  | Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins) | 
|  | Protein automated matches [259048] (1 species) not a true protein | 
|  | Species Mouse (Mus musculus) [TaxId:10090] [259049] (7 PDB entries) | 
|  | Domain d3wtug_: 3wtu G: [262464] Other proteins in same PDB: d3wtua_, d3wtuc_, d3wtuf_ automated match to d2jhba_ protein/DNA complex | 
PDB Entry: 3wtu (more details), 2.7 Å
SCOPe Domain Sequences for d3wtug_:
Sequence, based on SEQRES records: (download)
>d3wtug_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg
mgclefdeeraqqedala
>d3wtug_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpapsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdee
raqqedala
Timeline for d3wtug_:
|  View in 3D Domains from other chains: (mouse over for more information) d3wtua_, d3wtub_, d3wtuc_, d3wtuf_ |