Lineage for d1toc.2 (1toc C:,D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111959Protein Thrombin [50531] (2 species)
  7. 111960Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
  8. 111990Domain d1toc.2: 1toc C:,D: [26226]
    Other proteins in same PDB: d1tocr1, d1tocr2, d1tocs1, d1tocs2, d1toct1, d1toct2, d1tocu1, d1tocu2

Details for d1toc.2

PDB Entry: 1toc (more details), 3.1 Å

PDB Description: structure of serine proteinase

SCOP Domain Sequences for d1toc.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1toc.2 b.47.1.2 (C:,D:) Thrombin {Cow (Bos taurus)}
adcglrplfekkqvqdqtekelfesyieXivegqdaevglspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldkiyihpryn
wkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgnrretwtts
vaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvm
kspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOP Domain Coordinates for d1toc.2:

Click to download the PDB-style file with coordinates for d1toc.2.
(The format of our PDB-style files is described here.)

Timeline for d1toc.2: