Lineage for d1hrt.1 (1hrt L:,H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065213Protein Thrombin [50531] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
    Uniprot P00734 333-622
  8. 2065239Domain d1hrt.1: 1hrt L:,H: [26221]
    Other proteins in same PDB: d1hrti_

Details for d1hrt.1

PDB Entry: 1hrt (more details), 2.8 Å

PDB Description: the structure of a complex of bovine alpha-thrombin and recombinant hirudin at 2.8 angstroms resolution
PDB Compounds: (H:) thrombin (large subunit), (L:) thrombin (small subunit)

SCOPe Domain Sequences for d1hrt.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1hrt.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

SCOPe Domain Coordinates for d1hrt.1:

Click to download the PDB-style file with coordinates for d1hrt.1.
(The format of our PDB-style files is described here.)

Timeline for d1hrt.1: