Lineage for d4wo4c1 (4wo4 C:2-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368344Domain d4wo4c1: 4wo4 C:2-125 [262140]
    Other proteins in same PDB: d4wo4a1, d4wo4a3, d4wo4b_, d4wo4c2, d4wo4d2
    automated match to d2f54d1
    complexed with bma, fuc, jls, nag

Details for d4wo4c1

PDB Entry: 4wo4 (more details), 2.5 Å

PDB Description: the molecular bases of delta/alpha beta t cell-mediated antigen recognition.
PDB Compounds: (C:) TCR variable DELTA 1 CHAIN and TCR constant Alpha

SCOPe Domain Sequences for d4wo4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wo4c1 b.1.1.0 (C:2-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkvtqaqssvsmpvrkavtlnclyetswwsyyifwykqlpskemiflirqgsdeqnaksg
rysvnfkkaaksvaltisalqledsakyfcalgvtgkltfgqgtiltvhpn

SCOPe Domain Coordinates for d4wo4c1:

Click to download the PDB-style file with coordinates for d4wo4c1.
(The format of our PDB-style files is described here.)

Timeline for d4wo4c1: