SCOP 1.75: Domain d1ucy.3: 1ucy M:,N:

Lineage for d1ucy.3 (1ucy M:,N:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
   Uniprot P00734 333-622

8. Domain d1ucy.3: 1ucy M:,N: [26201]
   complexed with ace, opr

Details for d1ucy.3

PDB Entry: 1ucy, 2.2 Å

PDB Description: thrombin complexed with fibrinopeptide a alpha (residues 7-19). three complexes, one with epsilon-thrombin and two with alpha-thrombin

PDB Compounds: (M:) thrombin, (N:) thrombin

SCOP Domain Sequences for d1ucy.3:

Sequence; same for both SEQRES and ATOM records:

>g1ucy.3 b.47.1.2 (M:,N:) Thrombin {Cow (Bos taurus) [TaxId: 9913]}
tfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevglspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtryerkvekismldk
iyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakllhagfkgrvtgwgn
rretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdaceg
dsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs

Timeline for d1ucy.3:

• d1ucy.3 first appeared (with stable ids) in SCOP 1.55
  
• d1ucy.3 appears in SCOP 1.73
  
• d1ucy.3 appears in SCOPe 2.01
  
• d1ucy.3 appears in the current release, SCOPe 2.08