Lineage for d4riwb_ (4riw B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2587580Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2587581Species Human (Homo sapiens) [TaxId:9606] [82796] (129 PDB entries)
    Uniprot P00533 702-1018
  8. 2587771Domain d4riwb_: 4riw B: [261970]
    Other proteins in same PDB: d4riwa_, d4riwc_
    automated match to d3ikaa_
    complexed with adp, anp, mg

Details for d4riwb_

PDB Entry: 4riw (more details), 3.1 Å

PDB Description: Crystal structure of an EGFR/HER3 kinase domain heterodimer
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4riwb_:

Sequence, based on SEQRES records: (download)

>d4riwb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissil
ekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

Sequence, based on observed residues (ATOM records): (download)

>d4riwb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhavpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

SCOPe Domain Coordinates for d4riwb_:

Click to download the PDB-style file with coordinates for d4riwb_.
(The format of our PDB-style files is described here.)

Timeline for d4riwb_: