Lineage for d4quwa_ (4quw A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991585Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 1991596Protein automated matches [261918] (4 species)
    not a true protein
  7. 1991605Species Synechococcus elongatus [TaxId:1140] [261919] (5 PDB entries)
  8. 1991612Domain d4quwa_: 4quw A: [261920]
    automated match to d4kvqa_
    complexed with pl3

Details for d4quwa_

PDB Entry: 4quw (more details), 2.26 Å

PDB Description: crystal structure of the apo form of cyanobacterial aldehyde- deformylating oxygenase
PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4quwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quwa_ a.25.1.6 (A:) automated matches {Synechococcus elongatus [TaxId: 1140]}
eldfqsesykdaysrinaiviegeqeafdnynrlaemlpdqrdelhklakmeqrhmkgfm
acgknlsvtpdmgfaqkfferlhenfkaaaaegkvvtclliqsliiecfaiaayniyipv
adafarkitegvvrdeylhrnfgeewlkanfdaskaeleeanrqnlplvwlmlnevadda
relgmereslvedfmiaygealenigfttreimrmsayglaav

SCOPe Domain Coordinates for d4quwa_:

Click to download the PDB-style file with coordinates for d4quwa_.
(The format of our PDB-style files is described here.)

Timeline for d4quwa_: