SCOPe 2.06: Domain d4oy3a1: 4oy3 A:2-230

Lineage for d4oy3a1 (4oy3 A:2-230)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [189517] (16 PDB entries)

8. Domain d4oy3a1: 4oy3 A:2-230 [261867]
   Other proteins in same PDB: d4oy3a2
   automated match to d4p54a_
   complexed with cl, sah; mutant

Details for d4oy3a1

PDB Entry: 4oy3, 1.2 Å

PDB Description: Crystal Structure of the Helicobacter pylori MTAN-D198N mutant with S-Adenosylhomocysteine in the active site

PDB Compounds: (A:) Aminodeoxyfutalosine nucleosidase

SCOPe Domain Sequences for d4oy3a1:

Sequence; same for both SEQRES and ATOM records:

>d4oy3a1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisnnadekagmsfdefleksahtsakflksmvdel

Timeline for d4oy3a1:

• d4oy3a1 first appeared in SCOPe 2.04, called d4oy3a_
  
• d4oy3a1 was called d4oy3a_ in SCOPe 2.05
  
• d4oy3a1 appears in SCOPe 2.07
  
• d4oy3a1 appears in the current release, SCOPe 2.08