Lineage for d4nd1b2 (4nd1 B:165-333)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938743Protein Lactate dehydrogenase [56339] (18 species)
  7. 1938771Species Cryptosporidium parvum [TaxId:5807] [225186] (6 PDB entries)
  8. 1938779Domain d4nd1b2: 4nd1 B:165-333 [261823]
    Other proteins in same PDB: d4nd1a1, d4nd1b1
    automated match to d2ewda2
    complexed with gol, nad, oxm

Details for d4nd1b2

PDB Entry: 4nd1 (more details), 2.15 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with cofactor (b-nicotinamide adenine dinucleotide) and inhibitor (oxamic acid)
PDB Compounds: (B:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nd1b2 d.162.1.1 (B:165-333) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntiskvldnap

SCOPe Domain Coordinates for d4nd1b2:

Click to download the PDB-style file with coordinates for d4nd1b2.
(The format of our PDB-style files is described here.)

Timeline for d4nd1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nd1b1