PDB entry 4nd1

View 4nd1 on RCSB PDB site
Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with cofactor (b-nicotinamide adenine dinucleotide) and inhibitor (oxamic acid)
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: Rossmann Fold, Dehydrogenase, NAD binding, Oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2013-10-25, released 2014-12-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd7_480, LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CYZ2 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.05: d4nd1a1, d4nd1a2
  • Chain 'B':
    Compound: Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:353152]
    Gene: cgd7_480, LDH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5CYZ2 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.05: d4nd1b1, d4nd1b2
  • Heterogens: NAD, OXM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nd1A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nd1A (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nd1B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nd1B (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap