Lineage for d1dwb.1 (1dwb L:,H:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)
  6. 299132Protein Thrombin [50531] (2 species)
  7. 299168Species Human (Homo sapiens) [TaxId:9606] [50532] (137 PDB entries)
  8. 299296Domain d1dwb.1: 1dwb L:,H: [26180]
    complexed with ben

Details for d1dwb.1

PDB Entry: 1dwb (more details), 3.16 Å

PDB Description: crystallographic analysis at 3.0-angstroms resolution of the binding to human thrombin of four active site-directed inhibitors

SCOP Domain Sequences for d1dwb.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dwb.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)}
eadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOP Domain Coordinates for d1dwb.1:

Click to download the PDB-style file with coordinates for d1dwb.1.
(The format of our PDB-style files is described here.)

Timeline for d1dwb.1: