SCOPe 2.08: Domain d4txvc_: 4txv C:

Lineage for d4txvc_ (4txv C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (21 species)
   not a true protein

7. Species Bradyrhizobium diazoefficiens [TaxId:224911] [260055] (2 PDB entries)

8. Domain d4txvc_: 4txv C: [261605]
   automated match to d1jfub_

Details for d4txvc_

PDB Entry: 4txv, 2 Å

PDB Description: crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s)

PDB Compounds: (C:) thiol:disulfide interchange protein tlpa

SCOPe Domain Sequences for d4txvc_:

Sequence; same for both SEQRES and ATOM records:

>d4txvc_ c.47.1.10 (C:) automated matches {Bradyrhizobium diazoefficiens [TaxId: 224911]}
tgdpacraavataqkiaplahgevaaltmasaplklpdlafedadgkpkklsdfrgktll
vnlwatwcvpsrkempaldelqgklsgpnfevvainidtrdpekpktflkeanltrlgyf
ndqkakvfqdlkaigralgmptsvlvdpqgceiatiagpaewasedalkliraatgka

Timeline for d4txvc_:

• d4txvc_ first appeared in SCOPe 2.04
  
• d4txvc_ appears in SCOPe 2.07