Lineage for d1qhr.1 (1qhr A:,B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111959Protein Thrombin [50531] (2 species)
  7. 111995Species Human (Homo sapiens) [TaxId:9606] [50532] (126 PDB entries)
  8. 112084Domain d1qhr.1: 1qhr A:,B: [26151]

Details for d1qhr.1

PDB Entry: 1qhr (more details), 2.2 Å

PDB Description: novel covalent active site thrombin inhibitors

SCOP Domain Sequences for d1qhr.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qhr.1 b.47.1.2 (A:,B:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1qhr.1:

Click to download the PDB-style file with coordinates for d1qhr.1.
(The format of our PDB-style files is described here.)

Timeline for d1qhr.1: