SCOPe 2.05: Domain d4wczc_: 4wcz C:

Lineage for d4wczc_ (4wcz C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [226680] (3 PDB entries)

8. Domain d4wczc_: 4wcz C: [261464]
   automated match to d4olqe_

Details for d4wczc_

PDB Entry: 4wcz, 1.82 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from novosphingobium aromaticivorans

PDB Compounds: (C:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4wczc_:

Sequence; same for both SEQRES and ATOM records:

>d4wczc_ c.14.1.0 (C:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
smslrlerdgavarllidradrrnafsldmwqrlpellaeasgddalrvlvvksanggaf
cagadiaellankddaafhaanqqainraqyelarfrlptvamvegdcigggcgialacd
mriaapaarfgitpaklglvyplhdvkllvdlvgpgqarrlmftgglidaneahriglve
llgesedalvgqlatvssfstqaiksfvrrvldgqvaddadslrvfasafegadfregtg
aflekrppvf

Timeline for d4wczc_:

• d4wczc_ first appeared in SCOPe 2.04
  
• d4wczc_ is called d4wczc1 in SCOPe 2.06
  
• d4wczc_ appears in the current release, SCOPe 2.08, called d4wczc1