Lineage for d4wczc_ (4wcz C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585591Species Novosphingobium aromaticivorans [TaxId:279238] [226680] (3 PDB entries)
  8. 1585596Domain d4wczc_: 4wcz C: [261464]
    automated match to d4olqe_

Details for d4wczc_

PDB Entry: 4wcz (more details), 1.82 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from novosphingobium aromaticivorans
PDB Compounds: (C:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4wczc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wczc_ c.14.1.0 (C:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
smslrlerdgavarllidradrrnafsldmwqrlpellaeasgddalrvlvvksanggaf
cagadiaellankddaafhaanqqainraqyelarfrlptvamvegdcigggcgialacd
mriaapaarfgitpaklglvyplhdvkllvdlvgpgqarrlmftgglidaneahriglve
llgesedalvgqlatvssfstqaiksfvrrvldgqvaddadslrvfasafegadfregtg
aflekrppvf

SCOPe Domain Coordinates for d4wczc_:

Click to download the PDB-style file with coordinates for d4wczc_.
(The format of our PDB-style files is described here.)

Timeline for d4wczc_:

  • d4wczc_ appears in periodic updates to SCOPe 2.04 starting on 2014-12-04
  • d4wczc_ appears in SCOPe 2.05
  • d4wczc_ appears in the current release, SCOPe 2.07, called d4wczc1