Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) automatically mapped to Pfam PF02419 |
Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (10 PDB entries) |
Domain d4ub8l_: 4ub8 L: [261437] Other proteins in same PDB: d4ub8a_, d4ub8b_, d4ub8c_, d4ub8d_, d4ub8e_, d4ub8f_, d4ub8h_, d4ub8i_, d4ub8j_, d4ub8k_, d4ub8m_, d4ub8o_, d4ub8u_, d4ub8v_, d4ub8x_, d4ub8z_ automated match to d2axtl1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 4ub8 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub8l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub8l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d4ub8l_: