SCOPe 2.04: Domain d1awf.1: 1awf L:,H:

Lineage for d1awf.1 (1awf L:,H:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1awf.1: 1awf L:,H: [26141]
   complexed with gr4

Details for d1awf.1

PDB Entry: 1awf, 2.2 Å

PDB Description: novel covalent thrombin inhibitor from plant extract

PDB Compounds: (H:) alpha thrombin, (L:) alpha thrombin

SCOPe Domain Sequences for d1awf.1:

Sequence; same for both SEQRES and ATOM records:

>g1awf.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
adcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqellcgasl
isdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynw
renldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtanv
gkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmk
spfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

Timeline for d1awf.1:

• d1awf.1 first appeared (with stable ids) in SCOP 1.55
  
• d1awf.1 appears in SCOPe 2.03
  
• d1awf.1 appears in SCOPe 2.05
  
• d1awf.1 appears in the current release, SCOPe 2.08