Lineage for d4kxzm1 (4kxz M:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758216Domain d4kxzm1: 4kxz M:1-107 [261343]
    Other proteins in same PDB: d4kxza_, d4kxzb_, d4kxzd_, d4kxze_, d4kxzi2, d4kxzl2, d4kxzm2, d4kxzp2
    automated match to d1dn0a1
    complexed with mes, pe5

Details for d4kxzm1

PDB Entry: 4kxz (more details), 2.83 Å

PDB Description: crystal structure of tgfb2 in complex with GC2008.
PDB Compounds: (M:) GC1008 Light Chain

SCOPe Domain Sequences for d4kxzm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxzm1 b.1.1.1 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgip
drfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrlei

SCOPe Domain Coordinates for d4kxzm1:

Click to download the PDB-style file with coordinates for d4kxzm1.
(The format of our PDB-style files is described here.)

Timeline for d4kxzm1: