Lineage for d4kxzd_ (4kxz D:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963384Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1963385Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1963472Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 1963544Protein TGF-beta2 [57510] (1 species)
  7. 1963545Species Human (Homo sapiens) [TaxId:9606] [57511] (3 PDB entries)
  8. 1963550Domain d4kxzd_: 4kxz D: [259784]
    Other proteins in same PDB: d4kxzi1, d4kxzi2, d4kxzl1, d4kxzl2, d4kxzm1, d4kxzm2, d4kxzp1, d4kxzp2
    automated match to d2tgia_
    complexed with mes, pe5

Details for d4kxzd_

PDB Entry: 4kxz (more details), 2.83 Å

PDB Description: crystal structure of tgfb2 in complex with GC2008.
PDB Compounds: (D:) Transforming growth factor beta-2

SCOPe Domain Sequences for d4kxzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxzd_ g.17.1.2 (D:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs

SCOPe Domain Coordinates for d4kxzd_:

Click to download the PDB-style file with coordinates for d4kxzd_.
(The format of our PDB-style files is described here.)

Timeline for d4kxzd_: