| Class g: Small proteins [56992] (92 folds) |
| Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
| Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
| Protein TGF-beta2 [57510] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57511] (3 PDB entries) |
| Domain d4kxzd_: 4kxz D: [259784] Other proteins in same PDB: d4kxzi1, d4kxzi2, d4kxzl1, d4kxzl2, d4kxzm1, d4kxzm2, d4kxzp1, d4kxzp2 automated match to d2tgia_ complexed with mes, pe5 |
PDB Entry: 4kxz (more details), 2.83 Å
SCOPe Domain Sequences for d4kxzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kxzd_ g.17.1.2 (D:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
Timeline for d4kxzd_: