Lineage for d4omaa_ (4oma A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895951Protein automated matches [190399] (10 species)
    not a true protein
  7. 2895954Species Citrobacter freundii [TaxId:546] [261234] (7 PDB entries)
  8. 2895955Domain d4omaa_: 4oma A: [261236]
    automated match to d3mkja_
    complexed with cl, lcs, peg, pge

Details for d4omaa_

PDB Entry: 4oma (more details), 1.6 Å

PDB Description: The crystal structure of methionine gamma-lyase from Citrobacter freundii in complex with L-cycloserine pyridoxal-5'-phosphate
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d4omaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omaa_ c.67.1.3 (A:) automated matches {Citrobacter freundii [TaxId: 546]}
sdcrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygcthafls
hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
tggcmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
erlkagitdglirlsvgledpediindlehairkat

SCOPe Domain Coordinates for d4omaa_:

Click to download the PDB-style file with coordinates for d4omaa_.
(The format of our PDB-style files is described here.)

Timeline for d4omaa_: