Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein automated matches [190064] (22 species) not a true protein |
Species Mitrocoma cellularia [TaxId:31874] [261220] (1 PDB entry) |
Domain d4nqga_: 4nqg A: [261221] automated match to d4n1ga_ complexed with czh |
PDB Entry: 4nqg (more details), 1.3 Å
SCOPe Domain Sequences for d4nqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nqga_ a.39.1.5 (A:) automated matches {Mitrocoma cellularia [TaxId: 31874]} smgsryavkldtdfdnpkwiarhkhmfnfldinsngqinlnemvhkasniickklgatee qtrrhqkcvedffggagleydkdttwpeyiegwkrlaktelerhsknrvtlirlwgdalf diidkdgngsvsldewiqythcagiqqsrgqceatfahcdldgdgkldvdemtrqhlgfw ysvdstceglyggavpy
Timeline for d4nqga_: