SCOPe 2.05: Domain d4u0xb_: 4u0x B:

Lineage for d4u0xb_ (4u0x B:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (31 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (31 PDB entries)

8. Domain d4u0xb_: 4u0x B: [261166]
   automated match to d4neta_
   complexed with po4, zxm

Details for d4u0xb_

PDB Entry: 4u0x, 2.03 Å

PDB Description: structure of adc-7 beta-lactamase in complex with boronic acid inhibitor s02030

PDB Compounds: (B:) ADC-7 beta-lactamase

SCOPe Domain Sequences for d4u0xb_:

Sequence; same for both SEQRES and ATOM records:

>d4u0xb_ e.3.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
ntpkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsntif
elgsvsklftataggyaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalq
fpdevqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlektifp
alglkhsyvnvpktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanln
pqkyptdiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvta
iskepsvkmyhktgstsgfgtyvvfipkeniglvmltnkripneerikaayvvlnaik

Timeline for d4u0xb_:

• d4u0xb_ first appeared in SCOPe 2.04
  
• d4u0xb_ appears in SCOPe 2.06
  
• d4u0xb_ appears in the current release, SCOPe 2.08